PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn315561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 189aa    MW: 21421.6 Da    PI: 6.3563
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn315561genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.54.2e-201661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+WT+eEd+ll ++v   G g+W+tIar+++ gRt++++k++w+++
       Achn315561 16 KGPWTPEEDKLLNEYVSINGEGRWSTIARYLP-GRTDNEIKNYWRTH 61
                     79******************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.3391166IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-221269IPR009057Homeodomain-like
SuperFamilySSF466895.6E-181368IPR009057Homeodomain-like
SMARTSM007171.3E-171564IPR001005SANT/Myb domain
PfamPF002495.6E-181661IPR001005SANT/Myb domain
CDDcd001675.66E-151862No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MVGMTGWGDV EQGWRKGPWT PEEDKLLNEY VSINGEGRWS TIARYLPGRT DNEIKNYWRT  60
HFKKKAKPSE NQEKRKTQLL VKQKQSQQQV NDTNDPASPN VEVLSNKTTA ETPAKQETVF  120
AQTTIEDHCF PATHQEFAHW LDSSMDDGLW GGLWNLDDSR GRMAVQNQAS GHSCGGNTIN  180
WYNGGYNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032859.13e-46Myb domain protein 121
TrEMBLA0A061EFJ94e-46A0A061EFJ9_THECC; Myb domain protein 121
STRINGPOPTR_0004s11460.12e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-22myb domain protein 79